PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast01G307800.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family NAC
Protein Properties Length: 493aa    MW: 54707 Da    PI: 5.4651
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast01G307800.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.86.1e-5191361128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 
                         lppGf FhP+d elv++yLk+k+ g+++e  ++i+evdiyk+ePwdLp+  +v +++++w+fF+ rd+ky++g r+nrat +gyWk+tgkd
  Brast01G307800.1.p   9 LPPGFGFHPKDTELVSHYLKRKILGQRIEY-DIIPEVDIYKHEPWDLPAkcNVPTQDNKWHFFAARDRKYPNGARSNRATVAGYWKSTGKD 98 
                         79****************************.99***************5346667999********************************* PP

                 NAM  90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         +++++ ++++vg+kktLvf++gr p+g++t+W+mhey +
  Brast01G307800.1.p  99 RAIKV-DKRTVGTKKTLVFHEGRPPTGRRTEWIMHEYYI 136
                         *****.999****************************75 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.49E-594158IPR003441NAC domain
PROSITE profilePS5100555.39159IPR003441NAC domain
PfamPF023659.0E-2510135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
METLRNMTLP PGFGFHPKDT ELVSHYLKRK ILGQRIEYDI IPEVDIYKHE PWDLPAKCNV  60
PTQDNKWHFF AARDRKYPNG ARSNRATVAG YWKSTGKDRA IKVDKRTVGT KKTLVFHEGR  120
PPTGRRTEWI MHEYYIDENE CHACPDMKDA FVLCKVTKRV DWTSENGNEV GNSDPHPQQS  180
NVAATSAVSI EQPDAAAESV IGAELPNDVA TSAITAQTTT ADGDDEIQGW LEGMIDFSSV  240
DPVSAGLSLE EQNAESSNRG AMAPKVEPDY ASPNQFVVDD DSDYLLPDDI YNMLCPGSDD  300
FTPWHTEQAA LAFADQTYSI MGVDTFTLPS SFAEGTQNEE LQLPLEINEP NLSNEATDNG  360
VIVRTRQVKT PADNIPPYRT NRTRLQHSIN RMVTSSSESI NETIKFVDNG GRLDLMTNVE  420
HKKKHARDVT TIRQRDAGKS NRNQSNQGFF RGLRKSVWGC SAAGLNILVA ICMVGVAVAI  480
LHHGCHRTGI SL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-44716213172Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU0017230.0GU001723.1 Triticum aestivum cultivar Suwon11 NAC-domain transcription factor (NAC8) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566632.10.0PREDICTED: NAC domain-containing protein 74-like
SwissprotQ7GCL70.0NAC74_ORYSJ; NAC domain-containing protein 74
TrEMBLI1HE560.0I1HE56_BRADI; Uncharacterized protein
STRINGBRADI2G09530.10.0(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP75603847
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17260.11e-65NAC domain containing protein 86